PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco028389.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 282aa    MW: 31471.3 Da    PI: 6.6803
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco028389.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.25.9e-082302632154
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  k +yp++e++++L +++gL+ +q+ +WF N+R +
  Aco028389.1 230 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 263
                  469*****************************87 PP

2ELK271e-09184205122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELKh+L+++Y+++L+++++E++
  Aco028389.1 184 ELKHELKQGYKEKLIDIREEIL 205
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-191559IPR005540KNOX1
PfamPF037904.3E-181758IPR005540KNOX1
SMARTSM012562.9E-2872127IPR005541KNOX2
PfamPF037916.2E-2077126IPR005541KNOX2
PROSITE profilePS5121310.039184204IPR005539ELK domain
SMARTSM011880.004184205IPR005539ELK domain
PROSITE profilePS5007111.742204267IPR001356Homeobox domain
SMARTSM003895.1E-11206271IPR001356Homeobox domain
SuperFamilySSF466892.61E-16206270IPR009057Homeodomain-like
CDDcd000861.13E-11207268No hitNo description
Gene3DG3DSA:1.10.10.602.6E-25211268IPR009057Homeodomain-like
PfamPF059206.7E-18224263IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
GGGTGGGGEG TWQSARYKAD ILAHPLYEQL LSAHVACLRI ATPVDQLPRI DAQLAQSQHV  60
VAKYSVLNGG GGAAHMPDDK ELDQFMTHYV LLLCSFKEQL QQHVRVHAME AVMACWELEQ  120
SLQSLTGVSP GEGTGATMSD DDDEDQANSE ANLYDGLDGP DTLGFGPLVP TESERSLMER  180
VRQELKHELK QGYKEKLIDI REEILRKRRA GKLPGDTTST LKAWWQSHSK WPYPTEEDKA  240
RLVQETGLQL KQINNWFINQ RKRNWHSNPS SSSVLKSKRK R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12207271872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1260280RKRNWHSNPSSSSVLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6671421e-133KM667142.1 Ananas bracteatus clone 52544c microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039619.11e-179PREDICTED: homeobox protein knotted-1-like 3 isoform X3
SwissprotP480001e-177KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLM0TEV71e-179M0TEV7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P05170_0011e-179(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-166KNOTTED1-like homeobox gene 3